PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G05050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 468aa    MW: 49012.6 Da    PI: 6.9527
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G05050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.2e-40213289177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq+egC+adls ak+yhrrhkvC+ h+ka++vl++g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  OPUNC02G05050.1 213 RCQAEGCKADLSAAKHYHRRHKVCDYHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPT 289
                      6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.6E-34206275IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.094211288IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.94E-38212290IPR004333Transcription factor, SBP-box
PfamPF031102.7E-30214287IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MMSSRLNAGA MAAPAAAAEV VDFGYAPMPP YVGFDTAGMG GVSERPLFQH GGHGLYDGGL  60
DFSTAAAAAF PAAFQEAAAL GVGLSGSVAP GGNLLQSLAP AATTPSSLQM PMMMSLPGLP  120
ATAAPDVYPF GAGGFVKRED GPVLDVGGGG GGGRIGLNLG RRTYFSPADV LAVDRLLLRS  180
RLGGMGMGMG MGVGMGVLGL GLAAAHHHHQ PPRCQAEGCK ADLSAAKHYH RRHKVCDYHA  240
KAAAVLAAGK QQRFCQQCSR FHVLAEFDEA KRSCRKRLTE HNRRRRKPTA GGQSSKDSPP  300
PPPSKKGTDA SIASSYTSCD HKTASTTTAS GVSCLQELAD NDVGGHGQTA IAAGAAPPTL  360
SLASLPPQQE EDDEEEDGGL GTVLMMQQHQ QRRRRVQHDG DDAAAAAHHH HHLMRSLARQ  420
QQHRHSGGCS NNDDDDDDDN NNILSCSSAS DQQNSSNNNM HFFEVDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-282142871184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1270287KRSCRKRLTEHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0048380.0AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624330.11e-127PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ0E3F81e-160SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A0E0JW980.0A0A0E0JW98_ORYPU; Uncharacterized protein
STRINGORGLA02G0053800.11e-156(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.17e-34squamosa promoter binding protein-like 8